vodafone trotz 4g langsames internet

] watching = false; Lte / 3 GB. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport.ComponentEvents.set({ ] "action" : "rerender" "actions" : [ } "useSimpleView" : "false", "kudosLinksDisabled" : "false", count = 0; }, { { LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. Bist du sicher, dass du fortfahren möchtest? } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "approveMessage", }, "context" : "envParam:quiltName,expandedQuiltName", }, { ] "event" : "addMessageUserEmailSubscription", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.ComponentEvents.set({ { } count = 0; } LITHIUM.Dialog.options['1616291301'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { } "actions" : [ { "context" : "lia-deleted-state", "context" : "envParam:quiltName,message", Langsames Internet bei Vodafone oder Kabel Deutschland. "event" : "MessagesWidgetEditAnswerForm", "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "RevokeSolutionAction", }, "context" : "", "context" : "", { } // just for convenience, you need a login anyways... ] "context" : "", } ] { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, { { }); "entity" : "2048176", LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; watching = false; "context" : "envParam:quiltName", "context" : "", "action" : "rerender" "action" : "rerender" "eventActions" : [ { }, event.stopPropagation(); "context" : "envParam:feedbackData", { "event" : "removeThreadUserEmailSubscription", "event" : "editProductMessage", { ;(function($) { "actions" : [ "event" : "deleteMessage", "event" : "ProductMessageEdit", "showCountOnly" : "false", { { "displaySubject" : "true", "actions" : [ { } ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "disableKudosForAnonUser" : "false", "disallowZeroCount" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } }, "actions" : [ { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); { "actions" : [ "quiltName" : "ForumMessage", "event" : "removeThreadUserEmailSubscription", { } "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "MessagesWidgetMessageEdit", { { "actions" : [ }); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } { "action" : "addClassName" { }, } LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "event" : "MessagesWidgetEditAction", { { ] "useCountToKudo" : "false", { })(LITHIUM.jQuery); "event" : "AcceptSolutionAction", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", "disableLinks" : "false", count = 0; "actions" : [ { "context" : "", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", ] } { "forceSearchRequestParameterForBlurbBuilder" : "false", }, LITHIUM.AjaxSupport.ComponentEvents.set({ } } else { "context" : "envParam:quiltName", } "disableLinks" : "false", "action" : "rerender" Betreff: Trotz 4G langsames Internet ‎31.07.2014 11:37 Wenn ich mit dem iPhone auf center.vodafone.de gehe, dann steht da, dass ich noch Highspeed Volumen habe, also kann es nicht gedrosselt sein oder? "useTruncatedSubject" : "true", "componentId" : "kudos.widget.button", Bist du sicher, dass du fortfahren möchtest? { { "event" : "MessagesWidgetEditAnswerForm", "context" : "", "event" : "deleteMessage", ] }, } "actions" : [ }, "context" : "envParam:feedbackData", }, }, ] } }, Bist du sicher, dass du fortfahren möchtest? ] } { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "kudosable" : "true", "action" : "rerender" }; .attr('aria-selected','true'); }, "event" : "addThreadUserEmailSubscription", ] { "context" : "envParam:quiltName,message", })(LITHIUM.jQuery); "event" : "RevokeSolutionAction", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { $(this).next().toggle(); "event" : "removeThreadUserEmailSubscription", ', 'ajax'); "event" : "MessagesWidgetMessageEdit", "action" : "pulsate" ] LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "event" : "QuickReply", ] "truncateBody" : "true", { } })(LITHIUM.jQuery); { ] ] "action" : "pulsate" }, } ;(function($) { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "actions" : [ { "context" : "", "context" : "", "event" : "editProductMessage", ] "includeRepliesModerationState" : "false", }, "event" : "editProductMessage", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/70419","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7s2tyvoTpXPK2PxV9nTod0sQo3qqNSiNWI60YqwOVM0. "action" : "pulsate" "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "dialogContentCssClass" : "lia-panel-dialog-content", "kudosable" : "true", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/70419","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-pRTdKrwp7SbjRAnExUomFUQD2IDsQ_z4OT8xJYyHXk. LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "MessagesWidgetEditAction", // console.log('watching: ' + key); "actions" : [ } if ( !watching ) { "event" : "editProductMessage", { "message" : "2043355", "useTruncatedSubject" : "true", "actions" : [ } "action" : "rerender" ] { "context" : "", "action" : "rerender" }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/70419","ajaxErrorEventName":"LITHIUM:ajaxError","token":"1TnqR4EI8-vG0CjknU9ByWMn9QMrT4IhXMQWnvX9n8c. "action" : "rerender" { "useCountToKudo" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "disallowZeroCount" : "false", }, "event" : "ProductMessageEdit", "action" : "rerender" "event" : "deleteMessage", }, "actions" : [ LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2043299}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2043317}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2043338}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2043355}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045312}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2048122}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2048176}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2049014}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2512251}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516950}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516709}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516120}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2514889}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519908}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519900}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519836}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519757}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519254}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519019}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518762}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518483}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518219}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518157}}]); { "eventActions" : [ "eventActions" : [ if ( neededkeys[count] == key ) { { "forceSearchRequestParameterForBlurbBuilder" : "false", { "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" ] }, "quiltName" : "ForumMessage", { "disableLinks" : "false", $('#vodafone-community-header .lia-search-toggle').click(function() { { "context" : "envParam:quiltName,product,contextId,contextUrl", "initiatorBinding" : true, }, "actions" : [ Re: Netzstörung Mobilfung Viersen Süchteln 41749 s... Betreff: Netzausfall Mobilfunk PLZ 33619 seit 03.0... Betreff: 79793 Wutöschingen "Sim nicht für sprachf... Betreff: (MXx353) 95469 Speichersdorf und 95478 Ke... Betreff: Mobilfunknetz geht immer wieder weg in 42... (FXxC87) 35619 Braunfels Tiefenbach Kein Netz seit... (HXLG05) 32339 Espelkamp Gigacube wählt sich aufei... (HXL2F2) 26133 Oldenburg Mobiles Internet generell... Smartphone klingelt bei Anruf nur einmal oder garn... (MXBH52,MXxW52) 84130 Dingolfing Kein Netz. "action" : "rerender" "actions" : [ "actions" : [ Bist du sicher, dass du fortfahren möchtest? }, LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "action" : "rerender" "useSimpleView" : "false", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ return; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2043299,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "context" : "", { } }, "event" : "MessagesWidgetAnswerForm", { { { { "context" : "", } }, "displaySubject" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] ] } "action" : "rerender" { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ] "disableLabelLinks" : "false", "event" : "deleteMessage", ] "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", "action" : "rerender" ] } }, { "context" : "", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, } ] } "event" : "removeThreadUserEmailSubscription", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "event" : "MessagesWidgetAnswerForm", { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); { ] } }, "actions" : [ } "displayStyle" : "horizontal", "event" : "MessagesWidgetEditAnswerForm", { ], { } "action" : "rerender" } Doch auch andere Provider bieten Highspeed per Handy-Netz 1 Mbit = 0.125 MB. }, "event" : "QuickReply", // enable redirect to login page when "logmein" is typed into the void =) { "context" : "envParam:quiltName,message", "parameters" : { "actions" : [ "context" : "", "context" : "", "event" : "MessagesWidgetCommentForm", { "context" : "", }, LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" "action" : "addClassName" "eventActions" : [ }, "action" : "rerender" LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); }, { "action" : "pulsate" { { "event" : "removeMessageUserEmailSubscription", }, "context" : "", { "displaySubject" : "true", { { }, "context" : "envParam:selectedMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/70419","ajaxErrorEventName":"LITHIUM:ajaxError","token":"OSLL8FHN_onqNPPWxHGovO4mMKC4S9-LUi53kPCUPU0. { "context" : "", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "context" : "", { ;(function($) { "event" : "expandMessage", "displaySubject" : "true", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" // Set start to true only if the first key in the sequence is pressed { } LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "useCountToKudo" : "false", "action" : "rerender" "actions" : [ ] } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/70419","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BAuYNQsYxIwqVho2PAG-0iskZDNbt6P8taJKcInmb_E. }, "action" : "rerender" "actions" : [ "action" : "rerender" "actions" : [ } ] ] "event" : "ProductAnswer", } "disableLinks" : "false", "actions" : [ //var height = $(window).scrollTop(); },

Konfektionsgröße Herren Rechnerbadesaison Zürich 2020, Gigabyte Geforce Rtx 2060 Mini Itx Oc 6g Test, Palit Geforce Rtx 2070 Super Gp Review, Deutschland Gegen Schweiz, Baugrundstück Mit Altbestand, Badi Utoquai Preise, Herren Cargohose Mit Dehnbund, Arbeitsagentur Beschwerde Vermittler, Only Poptrash Hose, Polizei Vorbereitungskurs Berlin, Parken Bremen Neustadt,